Protein Info for Psest_0301 in Pseudomonas stutzeri RCH2

Annotation: Methylase of chemotaxis methyl-accepting proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 218 to 235 (18 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF03705: CheR_N" amino acids 19 to 70 (52 residues), 39.8 bits, see alignment 6e-14 PF01739: CheR" amino acids 86 to 274 (189 residues), 174.3 bits, see alignment E=4.2e-55

Best Hits

KEGG orthology group: K02661, type IV pilus assembly protein PilK (inferred from 84% identity to psa:PST_3949)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGM5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Psest_0301 Methylase of chemotaxis methyl-accepting proteins (Pseudomonas stutzeri RCH2)
MQPRFDWALEPLADMSPTEFHDWQTLLEERSGMVVSERRRSFLQTNLSARMREVGAPDYA
SYYRQVTSGPRGAVEWSTLMDRLTVQETRFFRHPASFELLDAYLRRRVAQSTLERPLALW
SVGCASGEETFSLAMATAEVLTGCEFNGGFGVTGTDISLSALAKSRAGIYGARKLEQVET
PLRERYFLPLPDARFQIIPGLAARVCFARLNVLELANSPVSGMDVIFCQNLLIYFRRWRR
REILNRLADCLAPGGLLVIGVGEVVGWQHPELLPVANDQVLAFTRKSL