Protein Info for PGA1_c30440 in Phaeobacter inhibens DSM 17395

Annotation: putative NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF16884: ADH_N_2" amino acids 9 to 114 (106 residues), 138.1 bits, see alignment E=1.6e-44 PF00107: ADH_zinc_N" amino acids 161 to 291 (131 residues), 62.1 bits, see alignment E=8.2e-21 PF13602: ADH_zinc_N_2" amino acids 194 to 339 (146 residues), 42.1 bits, see alignment E=2.4e-14

Best Hits

Swiss-Prot: 63% identical to CURA_ECOLI: NADPH-dependent curcumin reductase (curA) from Escherichia coli (strain K12)

KEGG orthology group: K07119, (no description) (inferred from 66% identity to kpn:KPN_01913)

MetaCyc: 63% identical to NADPH-dependent curcumin/dihydrocurcumin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6676; RXN0-6677

Predicted SEED Role

"Putative oxidoreductase YncB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUD8 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PGA1_c30440 putative NADP-dependent oxidoreductase (Phaeobacter inhibens DSM 17395)
MTQTSTTNRQFVLAERPKGEPTDSTLRLETTEVPTPGEGQMLLRNEYLSLDPYMRGRMSS
APSYAAPVEIDEVMVGGTVAEVVTSNVKGYEKGDWVVAFGGWQDYTLSDGTGVINMGKNP
QNPSWALGVLGMPGLTAWAGLTQIGQPKEGETLVVAGASGPVGATVGQIGKILGLRVVGI
AGGAEKCQHVIDTLGFDACIDYKADGFADDLAKAVPDGIDIYFENVGGAVFDAVMPLLNP
SARIPLCGLISQYNATALPEGPDRMNYLMGQLLRKRITMRGFIVFDDFGHLYPEFAKQMT
GWVQDGKVKYREEMIEGLEQAPAAFVGLLRGEAFGKRVIHLAD