Protein Info for PGA1_c30380 in Phaeobacter inhibens DSM 17395
Annotation: 30S ribosomal protein S21
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS21_RUEST: 30S ribosomal protein S21 (rpsU) from Ruegeria sp. (strain TM1040)
KEGG orthology group: K02970, small subunit ribosomal protein S21 (inferred from 91% identity to rsk:RSKD131_2076)Predicted SEED Role
"SSU ribosomal protein S21p" in subsystem Macromolecular synthesis operon or Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7F2R1 at UniProt or InterPro
Protein Sequence (68 amino acids)
>PGA1_c30380 30S ribosomal protein S21 (Phaeobacter inhibens DSM 17395) MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRARKLARK KAQREGLL