Protein Info for PGA1_c30340 in Phaeobacter inhibens DSM 17395

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 190 to 219 (30 residues), see Phobius details amino acids 240 to 272 (33 residues), see Phobius details PF09955: DUF2189" amino acids 94 to 220 (127 residues), 123.7 bits, see alignment E=2.8e-40

Best Hits

KEGG orthology group: None (inferred from 48% identity to sno:Snov_4239)

Predicted SEED Role

"FIG00919019: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0E9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PGA1_c30340 Predicted integral membrane protein (Phaeobacter inhibens DSM 17395)
MERTIGNPISWLAKSLGLTGSHVSASVDHLGSDKTGDMPRVLQLDIADLGAALRAGWQDF
TACRSDAMALVFLYPLIGVALVVLSLSMNLLPLVFPLVLGFALIGPVAAVGLYEMSSRRE
AGFTPHWMDAFAVLRSPAFLSILMLGLYLAALCILWLTMAAAIYNRTLGPEAPQSAMRFI
EDIFTTAPGWAMLVIGSAVGAAFAFAALAVSLVSFPLLLDRHIGLPIAVATSLRVVRRNL
WVSLVWGLIVALALLVAAIPMFAGMIVVVPVLGHATWHLYRRAVA