Protein Info for Psest_3037 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF10263: SprT-like" amino acids 10 to 107 (98 residues), 87.9 bits, see alignment E=3.9e-29 PF17283: Zn_ribbon_SprT" amino acids 118 to 158 (41 residues), 30.2 bits, see alignment E=3.6e-11

Best Hits

Swiss-Prot: 79% identical to SPRT_PSEAE: Protein SprT (sprT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02742, SprT protein (inferred from 94% identity to psa:PST_1272)

Predicted SEED Role

"Protein sprT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ88 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Psest_3037 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MPERLNARVEACYALAEQFFNRRFPRPEVSFKLRGQKAGVAHLQQNLLRFNEQLYRENTE
HFLRQTVAHEVAHLVAHQMFGSRIQPHGEEWQLIMRGVYELPPDRCHTYAVRRRAGTRYV
YRCSCVDQDFDFTAQRHALVAKGRRYYCRRCKTTLTFTGEQRRE