Protein Info for Psest_3036 in Pseudomonas stutzeri RCH2

Annotation: Yip1 domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details PF04893: Yip1" amino acids 7 to 179 (173 residues), 139.6 bits, see alignment E=4.9e-45

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_1273)

Predicted SEED Role

"FIG00956663: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQF3 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Psest_3036 Yip1 domain. (Pseudomonas stutzeri RCH2)
MIPHLVTLLTRPDQAWADIRRDEEKNSSNYLVHLLLWALLPAICMFIGTRYVGWSLVEDE
RIWLDTRSAFQLSALIYITIIVGTFIMGFFLRWMSRTFDARPTFNQCVGFVAYVITPFFL
AGLGALYPTRWIAILVLVAAGAYSTYLLFVGLPKFMRIDNRNTFLYGACTWGVGLLVLVN
LKVPMILFWMLALDPTYERDAPQNQSYGFEENRPQEEPGGVDNERRFNERPTE