Protein Info for Psest_3024 in Pseudomonas stutzeri RCH2

Annotation: cytochrome d oxidase, subunit II (cydB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00203: cytochrome d ubiquinol oxidase, subunit II
  • amino acids 1 to 380 (380 residues), 500.7 bits, E=1.6e-154
• PF02322: Cyt_bd_oxida_II
  • amino acids 7 to 361 (355 residues), 351 bits, E=3.1e-109

Best Hits

Swiss-Prot: 55% identical to CYDB_ECO57: Cytochrome bd-I ubiquinol oxidase subunit 2 (cydB) from Escherichia coli O157:H7

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 94% identity to psa:PST_1282)

MetaCyc: 55% identical to cytochrome bd-I subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bd oxidase electron transfer II (2/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bd oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

See L0GLB7 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_3024 cytochrome d oxidase, subunit II (cydB) (Pseudomonas stutzeri RCH2)
MFDYEVLKLVWWVLIGVLLIGFALTDGFDMGAMALMPFVGKTDNERRVAINTIAPHWDGN
QVWFITAGGALFAAWPMVYAVAFSGLYWAMLLVLFALFCRPVGFDYRSKVEDPRWRSAWD
WALFVGGAVPALVFGVAFGNLFLGLPFQLDELMRSTYQGSFFALLNPFALLCGIVSLSML
SAHGGAWLMLRTDGALAERSRQATRLCALVFLVGFLAAGLWLMLGVQGFTQLSVTDPGAA
LNPLLDKQVVQDNAGWLGNYGRYPITLIAPVAGILGALLALLGSSRNSGGASFVGTSLMI
VGSICTAGFALFPFVFPSSLDPASSLTIWDAVSSKKTLGIMFVVACIFVPLILCYTLWSY
VRMWGRLNQKTIEANPHGLY