Protein Info for HP15_2911 in Marinobacter adhaerens HP15

Annotation: phosphoglycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00162: PGK
  • amino acids 6 to 373 (368 residues), 491 bits, E=1.2e-151

Best Hits

Swiss-Prot: 96% identical to PGK_MARHV: Phosphoglycerate kinase (pgk) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 96% identity to maq:Maqu_3038)

MetaCyc: 71% identical to phosphoglycerate kinase (Escherichia coli K-12 substr. MG1655)
Phosphoglycerate kinase. [EC: 2.7.2.3]

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• heterolactic fermentation (14/18 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• oxygenic photosynthesis (11/17 steps found)
• glycerol degradation to butanol (10/16 steps found)
• gluconeogenesis III (7/12 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Sequence Analysis Tools

See E4PMG3 at UniProt or InterPro

Protein Sequence (386 amino acids)

>HP15_2911 phosphoglycerate kinase (Marinobacter adhaerens HP15)
MAIKRMTDLNLAGKRVLIREDLNVPVKDGKVSSDARIRASLPTIKAAKDAGAKVMLMSHL
GRPEEGVYDEASSMKPVADHLTKVLGQEVRLIKDYLDGVEVADGEVVLFENVRFNKGEKK
DNEDLAKKYAALCDVYVMDAFGTAHRAQASTHGVARFAPEACAGPLLAAELEALGKALDN
PAKPVVAIVGGSKVSTKLDVLNALEKVCDSIIVGGGIANTFLAAAGHPVGKSLCEHDLID
TAKEIASRVEIPLPVDVVVASEFAETATATVKNISDVTEDDMILDVGPETAGEFAELLKN
AKTILWNGPVGVFEFDQFGNGTKALAEAIAESDAFSLAGGGDTVAAVDKYGVADKISYIS
TGGGAFLEFVEGKTLPAVAVLEERGA