Protein Info for Psest_3014 in Pseudomonas stutzeri RCH2

Annotation: cob(I)alamin adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF12557: Co_AT_N" amino acids 1 to 26 (26 residues), 36.8 bits, see alignment (E = 2.9e-13) TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 29 to 203 (175 residues), 229.5 bits, see alignment E=1.1e-72 PF02572: CobA_CobO_BtuR" amino acids 33 to 203 (171 residues), 221.1 bits, see alignment E=1.1e-69

Best Hits

Swiss-Prot: 83% identical to COBO_PSEAE: Corrinoid adenosyltransferase (cobO) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 96% identity to psa:PST_1291)

MetaCyc: 52% identical to CobO (Pseudomonas denitrificans (nom. rej.))
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLA7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psest_3014 cob(I)alamin adenosyltransferase (Pseudomonas stutzeri RCH2)
MSESSERDDRHKARMQRKKALIDEKIAEAQDEYGLLLVHTGNGKGKSSSAFGMVARALGH
GIKVGVVQFIKGAASTGEEAFFRRFPDEVRYHVMGEGFTWETQDRQRDIAKAREAWAVAA
ELLADPEIGLVVLDELNIALKYGYLELAPVLADIESRPLLQHVVVTGRGAPPGLVEAADT
VTEMALVKHAFKAGVKAQKGVEF