Protein Info for Psest_3012 in Pseudomonas stutzeri RCH2

Annotation: cob(II)yrinic acid a,c-diamide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K04719, 5,6-dimethylbenzimidazole synthase [EC: 1.14.99.40] (inferred from 80% identity to pfv:Psefu_1876)

Predicted SEED Role

"Cobalamin biosynthesis protein BluB @ 5,6-dimethylbenzimidazole synthase, flavin destructase family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNG1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psest_3012 cob(II)yrinic acid a,c-diamide reductase (Pseudomonas stutzeri RCH2)
MSAHAFSQQERAAVYRAIGERRDMRHFAGGEVAPELLSRLLLAAHQAPSVGLMQPWRLIR
ITRAELRTAIADLVGEERQRTAEALGERSAEFMRLKVEGIEDCAELLVAALMDGREQHIF
GRRTLPEMDLASLACAIQNLWLTARAEGLGMGWVSLFDPAALAALLGMPDGAKPVAILCL
GPVHEFYPAPMLALEGWTTPRPLHELVFENAWEAK