Protein Info for Psest_3011 in Pseudomonas stutzeri RCH2

Annotation: ABC-type Fe3+-hydroxamate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF01497: Peripla_BP_2" amino acids 8 to 236 (229 residues), 140.3 bits, see alignment E=3.6e-45

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 94% identity to psa:PST_1294)

Predicted SEED Role

"Periplasmic binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ72 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Psest_3011 ABC-type Fe3+-hydroxamate transport system, periplasmic component (Pseudomonas stutzeri RCH2)
MSKGPQRIVCLSTETCETLYLLGEQARIVGISGFTVRPPQARKEKPKVSGFTSVKHEQIL
ALEPDLVLGYSDLQGDMLAELAREGLEVHLFNQRDIAGILRMIETLGALVHAGERARALA
TELQAGLDVIRASAAALPRRPRVYFEEWNEPLISGIAWVSELIELAGGEDCFAELAPCKR
AKDRVIEDPQEVVRRAPELIVGSWCGRRFRPEQVAARPGWQAIPAVRTGQLHEIKSPDIL
NPGPAVLTDGVRQLHALISACAQRAE