Protein Info for PGA1_c30000 in Phaeobacter inhibens DSM 17395

Annotation: ATP-dependent Clp protease adaptor protein ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF02617: ClpS" amino acids 30 to 108 (79 residues), 119.5 bits, see alignment E=2.1e-39

Best Hits

Swiss-Prot: 80% identical to CLPS_RUEST: ATP-dependent Clp protease adapter protein ClpS (clpS) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 80% identity to sit:TM1040_2534)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2N2 at UniProt or InterPro

Protein Sequence (113 amino acids)

>PGA1_c30000 ATP-dependent Clp protease adaptor protein ClpS (Phaeobacter inhibens DSM 17395)
MLPTPVMMSDHSDDDTDLGVLTKTRPKTQRPPRYKVLLLNDDYTPMEFVVMVLERFFNMT
HAEAFEVMLTVHKKGVAVVGVFSHEIAETKVGQVMDFAHRHQHPLQCTMEKEE