Protein Info for PGA1_c29980 in Phaeobacter inhibens DSM 17395

Annotation: putative short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00106: adh_short" amino acids 8 to 207 (200 residues), 118.9 bits, see alignment E=3.1e-38 PF13561: adh_short_C2" amino acids 14 to 256 (243 residues), 160.9 bits, see alignment E=6.2e-51

Best Hits

KEGG orthology group: K00076, 7-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.159] (inferred from 78% identity to sit:TM1040_2532)

Predicted SEED Role

"7-alpha-hydroxysteroid dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.159

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQQ0 at UniProt or InterPro

Protein Sequence (267 amino acids)

>PGA1_c29980 putative short chain dehydrogenase (Phaeobacter inhibens DSM 17395)
MSFSISGKTAIVTGSASGIGLAIGKQFAAAGANVMFADTDEKALLSELGAQADESNIRYF
AGDLRERLTIANLLSATIDAFDEVDILVNGARQVVPTDPLDPEDESMELLLNETLLPTMR
LSQQVARRMIKQGEQRDSSGPNGAIINLSSIAARRSHPELMAYCVASAALDQLTRSLSVS
LAPHRIRVNSIAFGSVMSASMQATLKDNRAYRQDIERHTPLGRIASPSELTEAAQFLASD
AAAFMTGQIVTLDGGRTLLDTVAVPVH