Protein Info for PGA1_c03070 in Phaeobacter inhibens DSM 17395

Annotation: putative uracil DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR00758: uracil-DNA glycosylase, family 4" amino acids 85 to 250 (166 residues), 186.3 bits, see alignment E=1.9e-59 PF03167: UDG" amino acids 99 to 243 (145 residues), 118.5 bits, see alignment E=1.3e-38

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 70% identity to sit:TM1040_3061)

Predicted SEED Role

"Uracil-DNA glycosylase, family 4"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW53 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PGA1_c03070 putative uracil DNA glycosylase (Phaeobacter inhibens DSM 17395)
MESALDYHSAHALLAWQIELGATDAIGDAPVNRYELQARLPKPGAAAAEVAPAKPRDIDP
VEVARQMAGAAGSLEGLYEALGQFEHCELKKGARNLVFADGQPGARVMVVGEAPGRDEDI
AGKPFVGRAGQLLDRMLAAIGLSRKDSVYIANVLPWRPPQNRDPLPAEIAMMTPFLERHI
ALAKPDILIAMGNISCDALLGKRGITRMRGTWQEAQGKPVMPMFHPAYLLRQPAQKRAAW
ADLLEIKARLTAD