Protein Info for Psest_3004 in Pseudomonas stutzeri RCH2

Annotation: cobalamin 5'-phosphate synthase/cobalamin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 179 to 207 (29 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 7 to 239 (233 residues), 127.2 bits, see alignment E=4.6e-41 PF02654: CobS" amino acids 7 to 237 (231 residues), 188 bits, see alignment E=1.2e-59

Best Hits

Swiss-Prot: 83% identical to COBS_PSEU5: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 83% identity to psa:PST_1301)

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL98 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Psest_3004 cobalamin 5'-phosphate synthase/cobalamin synthase (Pseudomonas stutzeri RCH2)
MLPLLIALQFLTSLPIRLPAMPEPEQQGRSLLYYPVVGLLLGALLCLAAFVLDGAPPLLQ
AALLLTLWAALTGGLHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPVAVVVLVLLLLL
KLAALLALLQAQHYVALLLAPLLGRAALLALFLGTPYVRPNGLGHALATNLPRTGAKGVL
LLVAIGCLLFGSSGLIALALAVVTFLLARRAMLRRLGGTTGDTAGALLELVECAVLVGLA
LQL