Protein Info for HP15_2892 in Marinobacter adhaerens HP15

Annotation: alkane 1-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details PF00487: FA_desaturase" amino acids 111 to 332 (222 residues), 113.3 bits, see alignment E=8.8e-37

Best Hits

Swiss-Prot: 68% identical to ALKB2_PSEAE: Alkane 1-monooxygenase 2 (alkB2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00496, alkane 1-monooxygenase [EC: 1.14.15.3] (inferred from 68% identity to pau:PA14_44700)

Predicted SEED Role

"Alkane-1 monooxygenase (EC 1.14.15.3)" (EC 1.14.15.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.15.3

Use Curated BLAST to search for 1.14.15.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PME4 at UniProt or InterPro

Protein Sequence (361 amino acids)

>HP15_2892 alkane 1-monooxygenase (Marinobacter adhaerens HP15)
MLTLKKYSYLIAMVPLLLPPLLLAAGQATDLVNLFSWGVPVVVFGIIPILDMLLGKDSLN
PDEETDVPRMVGERFYKAITLGWVAGFAALLVWSMLELASGTFSLVGSIGWIVSIGIVGG
LGINVAHELIHKDEKLETRAGGFLLSLVCYAGFKVEHLRGHHVHVSTPEDASSSRYNQSL
YNFLPQAYMRNFLNAWKLEAERLQRKGQKALSWRNELIWWYSISALALAGFTIAFGWLGA
LFFLGQSFIAFTLLEIVNYLEHYGLHRRKLENGRYERTGPEHSWNSNYFLTNVFLFHLQR
HSDHHAWAKRRYQILRHHDVAPQLPAGYSAMIVLAMFPPLWRRVMNPRVEAYYEGEEHQL
A