Protein Info for Psest_3001 in Pseudomonas stutzeri RCH2

Annotation: molybdenum ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 10 to 363 (354 residues), 506.9 bits, see alignment E=1.6e-156 PF00005: ABC_tran" amino acids 24 to 169 (146 residues), 114.6 bits, see alignment E=8.4e-37 PF03459: TOBE" amino acids 301 to 362 (62 residues), 55.6 bits, see alignment E=7.4e-19

Best Hits

Swiss-Prot: 76% identical to MODC1_AZOVI: Molybdenum import ATP-binding protein ModC 1 (modC1) from Azotobacter vinelandii

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 81% identity to psa:PST_1345)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ64 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Psest_3001 molybdenum ABC transporter, ATP-binding protein (Pseudomonas stutzeri RCH2)
MNDAATHSGIQARFRLDYADFSLDVDLQLPGRGVTALFGHSGSGKTTLLRCVAGLERSDQ
GELTVNGERWQNSAQNLFVPPHRRPIGYVFQEANLFTHLSVRRNLEFGMRRVPAPQRRVA
LEQAVELLGIDHLLERMPDRLSGGERQRVGIARALLTSPRLLLMDEPLAALDLKRKSEIL
PYLERLHDELDIPVLYVSHSPDEVARLADHVVLLEQGRAIAQGELRETLARLDLPTAFSD
DAGVVIEGEIAGHDAEYHLTRLSFPGGEVLVSQRPEALGQRLRFRVHARDVSLALQRAEG
SSITNLLPARVEAMVAADTPAHVLVRLDAGGTPLLARITRRSADQLAITPGQALWAQIKT
VALLG