Protein Info for PGA1_c29880 in Phaeobacter inhibens DSM 17395

Annotation: putative tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13393: tRNA-synt_His" amino acids 10 to 213 (204 residues), 69.2 bits, see alignment E=1.9e-23 amino acids 222 to 349 (128 residues), 45.3 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: K02502, ATP phosphoribosyltransferase regulatory subunit (inferred from 77% identity to sit:TM1040_0504)

Predicted SEED Role

"ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQP2 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PGA1_c29880 putative tRNA synthetase (Phaeobacter inhibens DSM 17395)
MGDRLSALSLAARLRMSFEAAGARVVEPPFLQPAETLLDLYGEDIRARAYVTSDALRGEQ
MLRPDFTVPVVEMHMRDGAEPARYTYAGDVFRRQEHDEDRANEYLQVGYEVFERHDPAGS
DAEVFALIALQLRDLPVRAATGDIGILMAAVEGLNTTSLRKAALMRHIWRPRRFRAMLDQ
FAGRSPVAGSRRKLLSTEGVLTGQVPAIGKRRPAEVDARVEALRADAAAPPIAENELTAL
EALMAVRETIPYASEQLRDIAVDLPAINPALDRLDARTAAMKARGIDVDNLDFEASYGRT
SMEYYDGFVFGFYADSRPDLPVIASGGRYDALTRQLGQGAEIPAVGGVVRPDLMLLLEGV
KS