Protein Info for Psest_2995 in Pseudomonas stutzeri RCH2

Annotation: ribonuclease D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF01612: DNA_pol_A_exo1" amino acids 6 to 172 (167 residues), 150.9 bits, see alignment E=3.2e-48 TIGR01388: ribonuclease D" amino acids 7 to 371 (365 residues), 454.2 bits, see alignment E=1.8e-140 PF00570: HRDC" amino acids 214 to 281 (68 residues), 59.6 bits, see alignment E=2.4e-20

Best Hits

Swiss-Prot: 72% identical to RND_PSEA7: Ribonuclease D (rnd) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03684, ribonuclease D [EC: 3.1.13.5] (inferred from 93% identity to psa:PST_1363)

Predicted SEED Role

"Ribonuclease D (EC 3.1.26.3)" in subsystem Experimental tye or tRNA processing (EC 3.1.26.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.13.5 or 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQB9 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Psest_2995 ribonuclease D (Pseudomonas stutzeri RCH2)
MAIETQWVLDDEHLTHLCAEWRQLPYVAVDTEFMRVDTFYPIAGLVQVGDGRRAYLIDPL
AVHDWSAFAAVLQDNAVVKVLHACSEDLEVLLRLTGSLPQPLFDTQLAAGYLNIGFSMGY
SRLVQAVLGIELPKGETRSDWLQRPLSDMQVQYAAEDAQHLAELYEALLPKLSEDKRAWV
LEDGAELVANLQRESDPEEAYREVKQAWRLKPQQLAVLKVLTAWRERQARARNQPRNRVL
REASLWPLARTQPRDLVTLARIEDMHPRTVRQDGEALLQMIGQAAATPEQDWPAPLPEPL
PLEVSSVLKKLRAVGQHEAKVLDIAPELMLRKKTLEALLKSGYPDGPYQLPDSLRGWRRE
RMGQALLEVLEKRP