Protein Info for PGA1_c29810 in Phaeobacter inhibens DSM 17395

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 61% identity to sit:TM1040_3764)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0A2 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PGA1_c29810 hypothetical protein (Phaeobacter inhibens DSM 17395)
MIARITGAAIRGIFVALLIAMPSLLLPDTATRSPEVIALLAILAAALTFAEYFSSYPSFV
EFREAPPLNRMRFISLALIVILVSLVARHPMDATALTSLVHGLASGLGDTLDFAFSPIQL
TGLMMPAHVAPDLITQVMAAAALSYMIALITIFGFALAIRLRDWPLGNGPFNVWTNLPLF
DPTTGGDVVERLQRDARINIVGGVLLPFALPAMVKLTSGVVDPGLLAAPQTLVWVVSAWA
FVPASMIMRGLAMLRISELIAQKRRAAYASSEALQTA