Protein Info for PGA1_c29760 in Phaeobacter inhibens DSM 17395

Annotation: iojap-like ribosome-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR00090: ribosome silencing factor" amino acids 13 to 110 (98 residues), 118.5 bits, see alignment E=5.8e-39 PF02410: RsfS" amino acids 16 to 110 (95 residues), 113.7 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 59% identical to IOJAP_ZYMMO: Ribosomal silencing factor RsfS (rsfS) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K09710, ribosome-associated protein (inferred from 74% identity to sit:TM1040_2506)

Predicted SEED Role

"Ribosomal silencing factor RsfA (former Iojap)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F098 at UniProt or InterPro

Protein Sequence (122 amino acids)

>PGA1_c29760 iojap-like ribosome-associated protein (Phaeobacter inhibens DSM 17395)
MATKSQPTSDELLARVLSSLNDDKAEDVVQIDLRGKTAIGDHMVIASGRSTRQVASMAEK
LADRLKQEYGMVCKVEGKDTGDWVLIDTGDIIVHLFRPEVREFYQLEKMWLPAGTSPAQS
EN