Protein Info for Psest_2981 in Pseudomonas stutzeri RCH2

Annotation: sodium pump decarboxylases, gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details TIGR01195: sodium pump decarboxylases, gamma subunit" amino acids 5 to 78 (74 residues), 65.7 bits, see alignment E=2.2e-22 PF04277: OAD_gamma" amino acids 9 to 76 (68 residues), 68.8 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 37% identical to OADG2_VIBCH: Probable oxaloacetate decarboxylase gamma chain 2 (oadG2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 60% identity to pmy:Pmen_2894)

Predicted SEED Role

"sodium pump decarboxylase, gamma subunit"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL78 at UniProt or InterPro

Protein Sequence (80 amino acids)

>Psest_2981 sodium pump decarboxylases, gamma subunit (Pseudomonas stutzeri RCH2)
MTPSQLLLEGVELMLFGIGFVFAFLVLLILCIRLMSYLTGRFVSEQPLQVAAAQAASAET
DADTLAAIQAAIHQHRARRG