Protein Info for Psest_2965 in Pseudomonas stutzeri RCH2

Annotation: fagellar hook-basal body proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 216 (216 residues), 155.5 bits, see alignment E=1.5e-49 amino acids 223 to 510 (288 residues), 179.3 bits, see alignment E=9e-57 PF00460: Flg_bb_rod" amino acids 4 to 33 (30 residues), 32.8 bits, see alignment (E = 1e-11) PF22692: LlgE_F_G_D1" amino acids 83 to 144 (62 residues), 43.4 bits, see alignment E=6.2e-15 PF07559: FlgE_D2" amino acids 247 to 409 (163 residues), 121.4 bits, see alignment E=8.4e-39 PF06429: Flg_bbr_C" amino acids 482 to 527 (46 residues), 50 bits, see alignment 3.3e-17

Best Hits

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL60 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Psest_2965 fagellar hook-basal body proteins (Pseudomonas stutzeri RCH2)
MSFNIGLSGLRAASKDLNVTGNNIANAGTVGFKQSRAEFSDVYAASVLGTGKNPQGSGVL
MSNISQQFNQGNINYTQNALDLAINGNGFFQISNNGAVSYTRAGYFGTDRSGFLVDNFGY
KLQGFPVDGNGNLQNGVIGDLQIQTTNQAPKATSQINTAFNLNSTQKSPVTWQSAYDASL
QPAYDAAYNTSLTTAGQAAYDAEFAVSGDPALAEDARAAALVNATNITNAQAAGNAAKAL
PANQAAALTAANGTFNPADPTTYNSSTSLNIYDSQGNAHVMTQYFVKTSANTWDMKVLID
GRNPASPAQEPPQPYVMGLTFDASGALTAIDNGGSGLFSVSPDRKVTLNSATGNPPSGGW
IPAISNGATPATWSANGALANPGGIVLDFSKSTQYASAFAVNSVAQDGYTTGELAGLEID
DTGVIFARYTNGQSKVQGQIILANFANVQGLTPVGKTQWVQSFESGEPVVGTPGSGTLGA
LQAGALEDSNVELSDQLVNLIVAQRNYQANAKTIETESAITQTIINLR