Protein Info for Psest_2964 in Pseudomonas stutzeri RCH2

Annotation: flagellar basal-body rod protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR03506: flagellar hook-basal body protein" amino acids 4 to 121 (118 residues), 119.5 bits, see alignment E=2.6e-38 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 31.8 bits, see alignment 1.7e-11 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 5 to 223 (219 residues), 188.7 bits, see alignment E=1.1e-59 PF22692: LlgE_F_G_D1" amino acids 81 to 145 (65 residues), 52 bits, see alignment E=9.4e-18 PF06429: Flg_bbr_C" amino acids 198 to 240 (43 residues), 54.4 bits, see alignment 1.1e-18

Best Hits

Swiss-Prot: 41% identical to FLGF_ECOLI: Flagellar basal-body rod protein FlgF (flgF) from Escherichia coli (strain K12)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 78% identity to pmy:Pmen_2846)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNW7 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Psest_2964 flagellar basal-body rod protein FlgF (Pseudomonas stutzeri RCH2)
MDKMLYVAMTGASQNARAQQAHANNLANISTTGFRRDFEQARSMQVFGDSHPARVYAMSE
RPATDFTSGTLQETGRDLDIAIEGEGWIAVQAPDGSEAYVRTGSLNIDVLGMLRTADGMP
VMGNGGPIAIPPEEKIDVGHDGTISIRALGENPNIVVTVDRIKLVNPDPKQLEKGTDGLI
RLKDGQPVEPDANVRVVSGFLEASNVNAVSEMTSILALSRQFELHVKMMRTAEDDAAAMA
RVLQLS