Protein Info for Psest_2961 in Pseudomonas stutzeri RCH2

Annotation: Flagellar basal-body P-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02119: FlgI" amino acids 22 to 365 (344 residues), 490.3 bits, see alignment E=1.4e-151

Best Hits

Swiss-Prot: 85% identical to FLGI_PSEPK: Flagellar P-ring protein (flgI) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 95% identity to psa:PST_1395)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ80 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Psest_2961 Flagellar basal-body P-ring protein (Pseudomonas stutzeri RCH2)
MWKKLLLLAGLLTLCAGAQAERLKDVATIHGVRSNQLIGYGLVVGLNGSGDQTTQTPFTV
QTFNNMLAQFGIKVPAGGNIQLKNVAAVSIHAELPPFAKPGQTIDITVSSIGNAKSLRGG
SLLMAPLKGIDGNVYAIAQGNLVVGGFDAGGADGSRITVNSPSAGRIPGGATVERPVPSG
FNQGNTLTLNLNRPDFTTAKNIVDQINDLLGPGVAQALDGGSISVTAPLDPSQRVDYLSI
LENLEVEVGQAVAKVIINSRTGTIVIGQNVRVQPAAVTHGSLTVTITEEPQVSQPEPFSD
GQTVVVPNSKVKAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEALKQAGALQ
ADLIVI