Protein Info for Psest_2960 in Pseudomonas stutzeri RCH2

Annotation: flagellar rod assembly protein/muramidase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 18 to 371 (354 residues), 285.1 bits, see alignment E=4.7e-89 PF10135: Rod-binding" amino acids 55 to 106 (52 residues), 65 bits, see alignment 7e-22 PF01832: Glucosaminidase" amino acids 232 to 372 (141 residues), 127.8 bits, see alignment E=4e-41

Best Hits

Swiss-Prot: 61% identical to FLGJ_PSEAE: Peptidoglycan hydrolase FlgJ (flgJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 80% identity to psa:PST_1396)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL42 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Psest_2960 flagellar rod assembly protein/muramidase FlgJ (Pseudomonas stutzeri RCH2)
MENRLGSGARGLDSGSYTDLNRLSQLKVGKDRDGEENVRKVAQEFESLFLNEMLKSMRAA
TEVLAKDNPLNSQASKQYQDMYDQQLSVSLSKEGGGIGLADVLVRQLSKQTETVTRNNPF
AQVAQTEGAAWPSKPAAGVESARDDSRLLNQRRLALPGKLSERQVANVSATAVPPAGDAV
QPLVNVDWKPATAFVPPADKPLTINGVEKGAPNAPSKTRFSSSQEFIATMLPMAEKAAER
LGIEPRFLVAQAALETGWGKSMIRQKDGSNSHNLFGIKATGWKGASATVTTTEYVNGKAT
REKAGFRAYDSFEQSFDDFVSLLENNDRYRTAIQVASNTGDSERFVKELQKAGYATDPQY
ARKISQIARKMQTYQTVADANSVPAMRTRG