Protein Info for Psest_2957 in Pseudomonas stutzeri RCH2

Annotation: competence protein ComEA helix-hairpin-helix repeat region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12836: HHH_3" amino acids 39 to 101 (63 residues), 81.1 bits, see alignment E=1.1e-26 TIGR00426: competence protein ComEA helix-hairpin-helix repeat region" amino acids 40 to 102 (63 residues), 80 bits, see alignment E=5.1e-27 PF03934: T2SSK" amino acids 42 to 103 (62 residues), 29.2 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: K02237, competence protein ComEA (inferred from 68% identity to psa:PST_1407)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ03 at UniProt or InterPro

Protein Sequence (104 amino acids)

>Psest_2957 competence protein ComEA helix-hairpin-helix repeat region (Pseudomonas stutzeri RCH2)
MNKAFLAAAAFAVLTSFSFGAHAATQSQPAPAPVAAVTQASVNLNTADAATLTRELKGIG
ATKAKAIVDYREEHGPFSSVDELLEVKGIGSATLQKIRSQLSVQ