Protein Info for PGA1_c00290 in Phaeobacter inhibens DSM 17395

Annotation: glycine betaine/L-proline transport system permease protein ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 24 to 186 (163 residues), 96.1 bits, see alignment E=1.1e-31

Best Hits

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET06 at UniProt or InterPro

Protein Sequence (196 amino acids)

>PGA1_c00290 glycine betaine/L-proline transport system permease protein ProW (Phaeobacter inhibens DSM 17395)
MTIYGATGSVLSDNQQAMLCILIGVPFGIWFGKSKRAYAVAEPVLDFMQTMPAFVYLIPI
IAFFGTGKPPGVLATLIFAMPPVIRLTALGMRGVPDATKEAAIAFGCSRRQLLFNVELPL
ALPSIMTGINQTILMSLSMVVIASLIGADGLGALILESLQYAAKGQGLLGGLAILLCAMV
IDRIAQGSYRRKIGKS