Protein Info for PGA1_c29460 in Phaeobacter inhibens DSM 17395

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details PF00892: EamA" amino acids 5 to 137 (133 residues), 45.1 bits, see alignment E=6.5e-16 amino acids 150 to 273 (124 residues), 33.6 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: None (inferred from 72% identity to sit:TM1040_2483)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F070 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PGA1_c29460 putative integral membrane protein (Phaeobacter inhibens DSM 17395)
MDTLRGSLLMVLAMAAFALEDMFIKSAARSLPVGQILILFGAGGMVIFAIVARAQGHRLW
NPVFCTRALLVRSVAEVAGRLCFTLAIALTPLSSASAILQATPLVVSAGAVVFFGEHVGL
RRWLAIAAGFIGVLMILRPGASGFELASLFAVAGTLGFAGRDLATRAAPAGLSNAHLGLA
GFAMLVVAGLIALPFGAPMKTPDVATTIDLAAVTLVGVVAYQALTGAMRVGEISVVAPFR
YTRLIFAMVLGVVVFHERPDMWTLIGSAVIVISGGFTLMRSNRRQVT