Protein Info for PGA1_c29410 in Phaeobacter inhibens DSM 17395

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details TIGR03644: probable ammonium transporter, marine subtype" amino acids 40 to 443 (404 residues), 634.1 bits, see alignment E=4.4e-195 PF00909: Ammonium_transp" amino acids 47 to 440 (394 residues), 331.4 bits, see alignment E=3.4e-103

Best Hits

KEGG orthology group: None (inferred from 74% identity to apb:SAR116_2465)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F067 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PGA1_c29410 ammonium transporter (Phaeobacter inhibens DSM 17395)
MRKSTLSLAAVATLALPGLALAQETAAAAPAGAAATDTVFILNSLLFLVGGFLVFWMAAG
FAMLEAGLVRSKNVTMQLTKNVALFSLAAIFYYLIGYNLMYPLGTWSIEGVLSGVWGPGV
LEAVGITSEQADDYSYASTGSDFFFQLMFCATTASIVSGTMAERVKLWPFLAFVIVLTAV
IYPLQASWKWGGGFLDEMGFLDFAGSTVVHSVGGWAALTGALILGPRLGKYKAGKTIPMP
GSNLALATLGTFILWLGWFGFNGGSQLAMGTVGDVADVSRIFANTNAAAAGGAVAALLLT
QLLFKKPDLTMVLNGALAGLVSITAEPLTPTLGMATLIGAAGGVIVVFVVPMLDKMKIDD
VVGAIPVHLVAGIWGTIAVVLTNPEASLVTQLTGIVVIALFVVISSAVVWLILRAVTGIR
VGEEDEVNGLDMSELGMEAYPEFSPS