Protein Info for Psest_2949 in Pseudomonas stutzeri RCH2

Annotation: Aspartyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF02127: Peptidase_M18" amino acids 12 to 423 (412 residues), 462.9 bits, see alignment E=1e-142 PF05343: Peptidase_M42" amino acids 298 to 417 (120 residues), 26.7 bits, see alignment E=3e-10

Best Hits

Swiss-Prot: 91% identical to APEB_PSEU5: Probable M18 family aminopeptidase 2 (apeB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01267, aspartyl aminopeptidase [EC: 3.4.11.21] (inferred from 91% identity to psa:PST_1421)

Predicted SEED Role

"Aspartyl aminopeptidase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNS1 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Psest_2949 Aspartyl aminopeptidase (Pseudomonas stutzeri RCH2)
MRKALNQGLIEYLQASPTPFHATENLAQALQAAGYRALDEREVWHTEAGGRYYVTRNDSA
IIAFQLGSKPLVEHGLRLVGAHTDSPCLRVKPQPELQRQGFWQLGVEVYGGALLAPWFDR
DLSLAGRVTYSRDGRIESQLINFKLPIATIPNLAIHLNREANQGWAINAQNELPPILAQI
ASQESPDFRALLADQLGREHGLVADVVLDFELSFYDTQAAAIIGLHGDFIAGARLDNLLS
CFAGLQALLNTEPEHSCVLVCTDHEEVGSTSLCGADGPFLEQVLRRLLPDEDDFQRTISH
SLLISADNAHAVHPNYADKHDGNHGPKLNAGPVIKVNNNQRYATNSETAGYFRHLCLENE
VPVQSFVTRSDMGCGSTIGPITASQLGVRTVDIGLPTFAMHSIRELAGSQDLAHLVKVLT
AFYNSSQLP