Protein Info for Psest_0290 in Pseudomonas stutzeri RCH2

Annotation: dihydroorotase, multifunctional complex type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 22 to 421 (400 residues), 293.4 bits, see alignment E=1.4e-91 PF12890: DHOase" amino acids 54 to 235 (182 residues), 88 bits, see alignment E=1.2e-28 PF01979: Amidohydro_1" amino acids 160 to 420 (261 residues), 45.8 bits, see alignment E=7.8e-16 PF07969: Amidohydro_3" amino acids 342 to 421 (80 residues), 32.8 bits, see alignment E=8.5e-12

Best Hits

Swiss-Prot: 79% identical to PYRX_PSEAE: Dihydroorotase-like protein (pyrC') from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 93% identity to psa:PST_3960)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFW5 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Psest_0290 dihydroorotase, multifunctional complex type (Pseudomonas stutzeri RCH2)
MVAIRILGARVIDPVSGRDEVADIFLQHGKIAAIGQAPAGFEAQRTIDGQGLIAAPGLVD
LAVALREPGYSRKGSIASETLAAAAGGITSLCCPPQTRPVLDTAAVTELILDRARESGHA
KVFPIGALTRNLAGEQLSELVALREAGCVAFGNGLTEFASNRNLRRALEYAATFDLTVIF
HSQDRDLAEGGLAHEGATASFLGLSGIPETAETVALARNLLLVEKSGVRAHFAQLTSARG
AEMIAQAQARGLPVTADVAMYQLILTDEALHGFSSLYHVQPPLRSAADRDGLREAVKAGV
ISAISSHHQPHETDAKLAPFGETEPGISSAEILLPLALTLVDDGLLDLPTLLARLTNGPA
AALQLPAGRLQAGQAADLVLFDRHSSTLVGERWYSKGRNCPFMGHCLPGSVRYTIVDGHV
SFEG