Protein Info for Psest_2939 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details PF04341: DUF485" amino acids 12 to 99 (88 residues), 112.7 bits, see alignment E=3.2e-37

Best Hits

Swiss-Prot: 57% identical to YJCH_ECOLI: Inner membrane protein YjcH (yjcH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to psa:PST_1431)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNR2 at UniProt or InterPro

Protein Sequence (104 amino acids)

>Psest_2939 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MNNENVYRQIYANPRFQELVAKRGRFAWLLSAVMLGAYLAFILLIAFEPQILGVPLSADT
VTTWGIPVGVGVIFMAFILTGVYVQRANGEFDRINQEILNEAQQ