Protein Info for PGA1_c29220 in Phaeobacter inhibens DSM 17395

Annotation: putative small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 100 to 130 (31 residues), see Phobius details PF21088: MS_channel_1st" amino acids 75 to 116 (42 residues), 35.7 bits, see alignment 9.9e-13 PF00924: MS_channel_2nd" amino acids 119 to 183 (65 residues), 66.8 bits, see alignment E=2.2e-22 PF21082: MS_channel_3rd" amino acids 191 to 272 (82 residues), 45.1 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 67% identity to rde:RD1_0945)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E466 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PGA1_c29220 putative small-conductance mechanosensitive channel (Phaeobacter inhibens DSM 17395)
MDSMNALMQTEIYNGKSLADLVTLEFLAQAMGSVLAATVILLAGFIVASWVKRRIVQIGD
SHASLDVTLFHFLGNLARYVILAFAVLFVLNTFGVQTTSIIAAIGAAGLAIGLAMQGALS
NVAAGIMLILFRPFKLGDFIEVNDEMGTVKEITLNNTVIASLSNLKVIIPNSEVWGNTIT
NYSEFDTRRAEWNFGVGYGANLATAEQVIRDTIMSDSRSHAEPEPFIQVNNLNSSSVDFL
VRVWVDAAEYFQYQADMKRKVKEALDAAGIDIPFPTRTLVQASPDASQQASEDGDQQDSA
ANRNEAAA