Protein Info for Psest_2927 in Pseudomonas stutzeri RCH2

Annotation: probable methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR03438: dimethylhistidine N-methyltransferase" amino acids 19 to 316 (298 residues), 397.6 bits, see alignment E=1.8e-123 PF10017: Methyltransf_33" amino acids 20 to 318 (299 residues), 357.1 bits, see alignment E=3.6e-111

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_1443)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPW9 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Psest_2927 probable methyltransferase (Pseudomonas stutzeri RCH2)
MALAIHFHDQLQQPHDASLRDETLAGFAAKPKWASPKFFYDRRGSELFEQICQQPEYYIT
RTEEQILAGAANDILDIAGPHSDLIELGSGASRKVRLLLEALHPTSYLGIDISEDFLLSS
TQRLAADYPWLEVHAACTDFSNELNLPDDFSSEHPLMFFPGSSIGNFTPGEAAAFLQRLH
DVLPAGGGLVIGVDLVKDRAVLEAAYNDRAHVTAAFNLNLLQRIRNELDSDIDPSRFIHR
AFYNEAESRIEMHLLSPEAQDVSIEGRRFHFDAGESLHTENSYKYTLESFAALAGASGFD
CLGQWTDPRDLFSVNYLQRR