Protein Info for HP15_286 in Marinobacter adhaerens HP15

Annotation: protein of unknown function YGGT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 128 (31 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details PF02325: CCB3_YggT" amino acids 4 to 82 (79 residues), 59.5 bits, see alignment E=1.6e-20 amino acids 101 to 178 (78 residues), 76.8 bits, see alignment E=6.6e-26

Best Hits

Swiss-Prot: 51% identical to Y392_PSEAE: Uncharacterized protein PA0392 (PA0392) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02221, YggT family protein (inferred from 92% identity to maq:Maqu_0534)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PL08 at UniProt or InterPro

Protein Sequence (194 amino acids)

>HP15_286 protein of unknown function YGGT (Marinobacter adhaerens HP15)
MLADILITILLIASTFYLTIVLLRFLLQLARADFYNPITQFVVKATNPPLRPLQRVIPGL
GGFDGASLVLAVIIQGITFFLILVALNGGIPAINPITLLVWAVLNVLDLIVKIYFWSVIA
VVVVSWIAPGSGHPAIQLVAQITEPVMRPVRNIMPSMGGLDLSPIIVFLILNVISVVIEH
MKMAAGLGSIGLGM