Protein Info for HP15_2811 in Marinobacter adhaerens HP15

Annotation: MscS mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 184 to 212 (29 residues), see Phobius details PF21088: MS_channel_1st" amino acids 159 to 200 (42 residues), 27.2 bits, see alignment 4.5e-10 PF00924: MS_channel_2nd" amino acids 202 to 267 (66 residues), 77.8 bits, see alignment E=8.1e-26 PF21082: MS_channel_3rd" amino acids 275 to 361 (87 residues), 50.7 bits, see alignment E=2.9e-17

Best Hits

KEGG orthology group: None (inferred from 72% identity to maq:Maqu_0360)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLI4 at UniProt or InterPro

Protein Sequence (388 amino acids)

>HP15_2811 MscS mechanosensitive ion channel (Marinobacter adhaerens HP15)
MDSKGVVQIMMESFGADLIEQLRRNLGDAFQAVSGENLDWGALLVQILGQLLVSVIYLGV
FLGVYLILIAAIRLGLGERRTKTPLYIQMRSGLRYLAGLGALVVILAQFGVSPEVLKAMA
RAGFMVLGFYVVWVVFRRLIKEGTSRYRMDPSIRQLVENLFAVIAATLAVVTVLAQFGFD
VVSIIAGLGIVGIAVGFAAQSTLSNFIAGITLLIERPFRIGDWVTINGQEGKVVKIALRT
TWLRTRDNIFTMIPNDSVASTDIINYSAEGVTRLNIPVGIAYKESAKAAREVLMPVLLAH
PEVLQGAGMEPRVLLKSLGDSSVNLEVKVWITPDNLDVRPRIMADILEQMKEALDAAGIE
IPFPHLQLFIDDAKGLKPVLEPFYRLRG