Protein Info for PGA1_c29110 in Phaeobacter inhibens DSM 17395

Annotation: intracellular protease PfpI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 8 to 175 (168 residues), 168.9 bits, E=4.5e-54
• TIGR01382: intracellular protease, PfpI family
  • amino acids 8 to 176 (169 residues), 163.5 bits, E=1.6e-52

Best Hits

Swiss-Prot: 43% identical to YRAA_BACSU: Putative cysteine protease YraA (yraA) from Bacillus subtilis (strain 168)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 64% identity to rpd:RPD_3967)

MetaCyc: 40% identical to protein/nucleic acid deglycase 2 (Escherichia coli K-12 substr. MG1655)
GLYOXIII-RXN [EC: 4.2.1.130]; RXN-17632 [EC: 4.2.1.130, 3.5.1.124]

Predicted SEED Role

"ThiJ/PfpI family protein"

MetaCyc Pathways

• methylglyoxal degradation IX (1/1 steps found)

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.-.- or 3.5.1.124 or 4.2.1.130

Sequence Analysis Tools

See I7EQI1 at UniProt or InterPro

Protein Sequence (183 amino acids)

>PGA1_c29110 intracellular protease PfpI (Phaeobacter inhibens DSM 17395)
MPRITDAKILMIATHGFEQSELEFPRDQLRVKSAEVSVASLDGKAIKGWEGDDWGREAEA
DLALEAVRVDDYDALVLPGGQINPDLLRINDDVIELINAFYDQGKVVAAICHAPWLLIEA
GLVKGRTMTSFQSIKTDMINAGADWQDAEVVADNGIVTSRNPDDLKAFAGKIVEEIEEGR
HSR