Protein Info for HP15_2802 in Marinobacter adhaerens HP15

Annotation: alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 33 to 255 (223 residues), 90.6 bits, E=3.3e-29
• PF12146: Hydrolase_4
  • amino acids 34 to 254 (221 residues), 56.6 bits, E=6.2e-19
• PF12697: Abhydrolase_6
  • amino acids 34 to 260 (227 residues), 88.7 bits, E=2.3e-28
• PF00975: Thioesterase
  • amino acids 34 to 113 (80 residues), 35.5 bits, E=3.2e-12

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• catechol degradation to β-ketoadipate (1/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (1/4 steps found)
• catechol degradation III (ortho-cleavage pathway) (2/6 steps found)
• 4-methylcatechol degradation (ortho cleavage) (2/7 steps found)
• superpathway of salicylate degradation (2/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• aromatic compounds degradation via β-ketoadipate (2/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (2/11 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See E4PLH5 at UniProt or InterPro

Protein Sequence (271 amino acids)

>HP15_2802 alpha/beta hydrolase fold protein (Marinobacter adhaerens HP15)
MSEGTNMEQQMPRSIVRLAHGRLSYLENGSGTPVLFLHGLNGNGSSWVDQLSALATSMKM
WAWDAPGYGQSDVAGDSVTDLAKVAIEFLETCGPGPVNLVGHSMGGLVAMKIAIMKPELV
KRLVLSCTHPGHGLTDGANDRYQRRLRELEELPKQEYGRRRAKGMLPEGTSEVLFQRVAA
IAAESRPDGVVNAAWAIQTANLIPELGKIQAPTLVVTCDKDSVAPLKKAEPLLEHIPDVQ
HVELSGLGHAPYLEDAERYNSVLSDFLLANG