Protein Info for HP15_2792 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator MarR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF12802: MarR_2" amino acids 45 to 104 (60 residues), 43.1 bits, see alignment E=7.8e-15 PF01047: MarR" amino acids 47 to 105 (59 residues), 60.3 bits, see alignment E=2.6e-20 PF13463: HTH_27" amino acids 47 to 113 (67 residues), 31.4 bits, see alignment E=3.7e-11 PF01638: HxlR" amino acids 54 to 120 (67 residues), 21.6 bits, see alignment E=3.3e-08

Best Hits

Swiss-Prot: 48% identical to OHRR_BACSU: Organic hydroperoxide resistance transcriptional regulator (ohrR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 64% identity to dda:Dd703_0519)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLG5 at UniProt or InterPro

Protein Sequence (164 amino acids)

>HP15_2792 transcriptional regulator MarR family protein (Marinobacter adhaerens HP15)
MSEHQSFNQSAPGDDLLTLDRQMCFALYSASLAMTKLYKPLLSELGLTYPQYLVMLVLWE
TDGVRVSGLKERLFLDYGTLTPLVKRLEKQGLLVRQRSPQDERQVIVLLTEKGRSLQQAA
ARVPERVASASGCSLAELEDLKTELCALRNRLHSHLDSHLEESA