Protein Info for PGA1_c28920 in Phaeobacter inhibens DSM 17395

Annotation: 'RNA polymerase sigma factor (sigma-70 family; ECF41 subgroup)'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 159 (145 residues), 50.6 bits, see alignment E=8.7e-18 PF04542: Sigma70_r2" amino acids 17 to 77 (61 residues), 46.1 bits, see alignment E=3.4e-16 PF08281: Sigma70_r4_2" amino acids 106 to 157 (52 residues), 48.2 bits, see alignment 6.7e-17

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 69% identity to sit:TM1040_0151)

Predicted SEED Role

"RNA polymerase ECF-subfamily sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E436 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c28920 'RNA polymerase sigma factor (sigma-70 family; ECF41 subgroup)' (Phaeobacter inhibens DSM 17395)
MTAQTKDTGTDAFLTARPRLFAAAYRMLGSVTDAEDILQDAYLRWQSAPKSEVLDPTGYL
MRITTRLCLDQLKSARKQRETYPGEWLPEPVLTDDATDQLDHDVSVALLLALDALSPLER
AAFLLHDIFDSSYGDVASALNRSPEACRQLATRARRKVQALRPEAPSRTDQGEALTEAFF
RASKTGDMTTLTRLLSEDVQLISDGGGKTMAALNPIYGRDKVLRLLAGLARKAHHTAPDH
WRLCQLNGLPAIVSRGEDGILQATSLDIRADRITRIYVTRNPDKTRHLASVLG