Protein Info for PGA1_c28910 in Phaeobacter inhibens DSM 17395

Annotation: carboxymuconolactone decarboxylase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF02627: CMD" amino acids 22 to 93 (72 residues), 65.3 bits, see alignment E=2.1e-22 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 34 to 78 (45 residues), 53.5 bits, see alignment E=6.3e-19

Best Hits

Swiss-Prot: 44% identical to YDFG_BACSU: Uncharacterized protein YdfG (ydfG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to sit:TM1040_0152)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase domain/alkylhydroperoxidase AhpD family core domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQG4 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PGA1_c28910 carboxymuconolactone decarboxylase-like protein (Phaeobacter inhibens DSM 17395)
MTQRLDYFSAAGDLFKPMMEQENLFKNSTLEFSVVELVKLRASQINGCAFCIHMHTHEMR
AHGESEDRMHLLNAWRESPLYTPRERAALAWCEALTRVEATAAPDADYDAVADLFEPREQ
VLLTLLIGAINSWNRIAIGFRSAHPVSESTTGANAA