Protein Info for PGA1_c28900 in Phaeobacter inhibens DSM 17395

Annotation: putative DMSO reductase anchor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04976: DmsC
  • amino acids 49 to 156 (108 residues), 45.1 bits, E=4.7e-16

Best Hits

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 72% identity to sil:SPO3557)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

• NADH to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

See I7F021 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PGA1_c28900 putative DMSO reductase anchor subunit (Phaeobacter inhibens DSM 17395)
MHPAPSVILFTTLSGLGFGLLAFLGFGKPAVTGWVAFVFYAIAFGFAVGGLLASTFHLGR
PERAWRAFTQWKTSWLSREGICAVAALIVMGLFAFGAVFLDTHWWVLGWIGAALSLATVF
TTSMIYTQLKTIPRWNMSLTPVMFLSFSLAGGSLLAGAEALAPWLLAIAGSVQLAYWAKG
DQAFASSGTDMGTATGLGDRGTVRAFEPPHTGSNYLLREFVHVVGRKHAQKLRVIAFALG
FALPLICLILPVEGLMAKHLLAGIAVLLHIAGIAVSRWLFFAQAEHVVGLYYGKR