Protein Info for HP15_2784 in Marinobacter adhaerens HP15

Annotation: 3-ketoacyl-(acyl-carrier-protein) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00106: adh_short" amino acids 7 to 200 (194 residues), 222.7 bits, see alignment E=4.9e-70 TIGR01830: 3-oxoacyl-[acyl-carrier-protein] reductase" amino acids 9 to 246 (238 residues), 309.5 bits, see alignment E=8.5e-97 PF08659: KR" amino acids 9 to 161 (153 residues), 70.4 bits, see alignment E=2.9e-23 PF13561: adh_short_C2" amino acids 13 to 245 (233 residues), 223.1 bits, see alignment E=6e-70

Best Hits

Swiss-Prot: 48% identical to FABG_STAEQ: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 69% identity to chl:Chy400_1585)

MetaCyc: 45% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLF7 at UniProt or InterPro

Protein Sequence (247 amino acids)

>HP15_2784 3-ketoacyl-(acyl-carrier-protein) reductase (Marinobacter adhaerens HP15)
MQDLKGKVALVTGASRGIGRHIALQLAQRGADVAINYRSRQSEGEEVAKEIEATGVRALS
FKADLSKMPEARSLVRQVQEQWGRIDILVNNAGITKDKSMKKLTDDDWNDVLDTNLGSVY
ATCSEVLKIMMDQKYGRIINITSFVGQAGNFGQANYAASKGGIIAFTKTLALEMAKYNIT
VNAIAPGFTETEMLAQVPENIREQIIARVPMGRFGKPEEIARAVVFLAAEGDYITGQQIN
VNGGVYM