Protein Info for Psest_2895 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 305 to 322 (18 residues), see Phobius details amino acids 336 to 349 (14 residues), see Phobius details amino acids 398 to 411 (14 residues), see Phobius details PF03235: GmrSD_N" amino acids 21 to 216 (196 residues), 100.2 bits, see alignment E=8.8e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ05 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Psest_2895 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MSKRDPKPEVLRLEELALLVKSGDIKLPSFQRSFVWKRADMLKLLDSIYKGYPIGSILLW
NSSQRLKSERDIAGLQVNDEHTVYPTNYLLDGQQRLTTLCGAIFWEGGPASSIWNIHFDL
ETESFVYPRENDQLTLFPLNKLMSTRDFIFQCMKYEHHPNKVIYTDRAERLLRSVKDYKV
AVVKIGDMSIEEVAPIFERINSTGRKLTIVDLMMAATWSNGFDLSAEIEETKAACTALGF
GGISEQMILRSIAASANLGINKEDIQRLRNLSPVELKEAASKSCAAFISAASWIMNNLPI
RDASYLPYGLFLTYLVEIFRVSGGLSDEQSKAVLSWFWYTSATLYFGGASTGQISRDLNV
VREFASGSRVSLYVQVEIDISRLLFDKFNLKNASSTTFALLLLSVSGGTAISGRPIPLDL
IGAKDSRIFGRISPDNIADKNISVVIDVQRNGSSEIGVELEKQLLSNDCVFDAERQDEIS
FVINRANLVSSFIESVCGCQSHYSIEALMSLQLADNGDSADID