Protein Info for PGA1_c28830 in Phaeobacter inhibens DSM 17395

Annotation: sulfite exporter tauE/safE-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 5 to 11 (7 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 33 to 59 (27 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details PF01925: TauE" amino acids 15 to 240 (226 residues), 47.8 bits, see alignment E=7.9e-17

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 69% identity to sit:TM1040_0154)

Predicted SEED Role

"Bll0704 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2E1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PGA1_c28830 sulfite exporter tauE/safE-like protein (Phaeobacter inhibens DSM 17395)
MPLPFDLSMGAGAFLAAALFAAAFIRGYSGFGFSAIFIILAALVTNPLPLIPVVFACEIA
MTVFQARGIRPHIDWRRSFALLAGAAVATLPAVAVMARLGPDQARLVISVLIFVLSLLLL
SGWSLARPIGTAGHVAVGMASGMANSAGVGGLPAAAFMTAQPIPPAVFRATMIVFLTGID
LMALPVMSAHGLTGPDTLWGVLLAFPILGAGVWVGSRGFALAAPHLFRRYVVTLLAALAA
LNIAKVAL