Protein Info for Psest_2888 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional activator of acetoin/glycerol metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF00158: Sigma54_activat" amino acids 332 to 493 (162 residues), 211.9 bits, see alignment E=1.2e-66 PF14532: Sigma54_activ_2" amino acids 341 to 500 (160 residues), 72.1 bits, see alignment E=1.5e-23 PF07728: AAA_5" amino acids 351 to 470 (120 residues), 32.9 bits, see alignment E=1.5e-11 PF02954: HTH_8" amino acids 586 to 623 (38 residues), 44.8 bits, see alignment 2.1e-15

Best Hits

KEGG orthology group: None (inferred from 63% identity to pau:PA14_11830)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNL3 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Psest_2888 Transcriptional activator of acetoin/glycerol metabolism (Pseudomonas stutzeri RCH2)
MTSRLSQHAHQVLSFGEGTAASQGPAADPAIARSWRRCLEQHQLDPTSPRAPCVIERPRL
NEHRDRLDRVIAVAHWQMNSLHQQLGSSGHAVLLTDASGVVIDSVADQAERAEFQRAGLW
LGAVWNEATEGTNGVGLCLLERQALTIRRDEHFRGRHAALTCSASPVFDAEGGLLAVLNV
SSAREDLSRQRRFHTMALTNLSAKLIESCFFLQHCEGDYLLRFHAQPEYIGLLSEGLLAF
DGDGRITTINETALNLLASGREALLGQPLETILDVRLEQLLQRARPQPGTCWPLHTHDGQ
RLYCQLRGPQMRVVVAPPKEAAAQVGGLCLLDPSMRTDFSRALKVLERDVPVLLQGETGT
GKEAFASALHRASSRAGRPFVALNCAAIPETLIESELFGYRGGSFTGARREGMVGKLEQA
NGGILFLDEIGDMPLALQTRLLRVLEERKVTPLGAAAPAELNIRLISASHHDLRALVAGG
AFREDLYYRLGGLMVALPPLRERSDKAELLDHLLAEEAQGESISLDPAARQALLAYRWPG
NVRQMRNLLRTLVALSEQGRIAVDEVLAVLPAEIGEADAMRDPLQSAEREALLSVLRERH
WQVSRVAEELGISRNTLYRKLRKHGISRN