Protein Info for Psest_2884 in Pseudomonas stutzeri RCH2

Annotation: HAD-superfamily phosphatase, subfamily IIIC/FkbH-like domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 PF21211: FkbH_N" amino acids 70 to 233 (164 residues), 27 bits, see alignment E=3.9e-10 PF13472: Lipase_GDSL_2" amino acids 91 to 232 (142 residues), 34.6 bits, see alignment E=2.8e-12 TIGR01686: FkbH domain" amino acids 271 to 600 (330 residues), 291.4 bits, see alignment E=8.2e-91 TIGR01681: HAD phosphatase, family IIIC" amino acids 272 to 393 (122 residues), 59.2 bits, see alignment E=7.7e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2876)

Predicted SEED Role

"FIG00991770: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKV1 at UniProt or InterPro

Protein Sequence (633 amino acids)

>Psest_2884 HAD-superfamily phosphatase, subfamily IIIC/FkbH-like domain (Pseudomonas stutzeri RCH2)
MAQLPWLPTHMDLSAAIGQAKRIDDPLQRLHEAARLATFQRDFTLTARLDKLAATGIEQH
AAAARLTPLRVALLSSHTVDHLLPAIRVAGLQRRLALSLHVAPYGMYRQALLADDPELNA
FAPQLVLLALDAHDAPLQLPLQAGQAEVDAAVAERVDELRLLWRRARERYAAQVVQQTLV
PVAPPLFGSYEALVPASPRAVIERLNAAIRAAAREDGVLLLDLAWHAAAYGDGLAEPVRW
HQAKQLVSPTLAPLYGEHLARIAAATAGLSRKCLVLDLDNTLWGGVIGDDGIDGIQLGQG
SASGEAFLALQRYAAQLARRGVILAVCSKNDLHVAEAAFAHPEMALERSDIAAFVANWED
KAGNLRRIASMLDIGLDSLVFVDDNPAERDIVRRELPQVAVPELPDDVADYPARIAAAGY
FEAVSFTSDDAERGRSYALNAERKAALNQATDMDGYLRGLQMVLRVSRIGAAELARATQL
INKTNQFNLTTRRYTEAEVERMASDPRTIALAPRLEDKFGDNGLISVVLARPDDALQADE
LLIDSWLMSCRVLGRQVEAAVLELLADAAAAAGWGVLVGEYRPTERNGMVAEHYPRLGFQ
QRPAPAHAITDASFWRYELASRAPIHHHIQVQA