Protein Info for Psest_2881 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 15 to 275 (261 residues), 135.4 bits, see alignment E=1.5e-43 PF03631: Virul_fac_BrkB" amino acids 24 to 277 (254 residues), 239.6 bits, see alignment E=2.4e-75

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 90% identity to psa:PST_1499)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPS3 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Psest_2881 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MAMLDTRGIGAFTLLKRTFKEFSSDDMSTYASALAYRGLFAMFPFLVFLIALLGFLDLQN
FFDWLRMQASLALPPIAMEQIDPVIEQLQEQQAGLLSFGILVALWTASVGFRSLMNAMNR
AYDVEEGRPSWKLIMLSLAYTVGIAVLLLLTAGLMIVGPQAIEWLAGQVGMRDMVVVLWT
WARWPVVVLTLMLVVALLYYVTPDVEQDFRFITPGSVLAVLVWILASIAFGIYVQNFADY
NATYGSIGAIIVLLLYLYISAAVLLFGAELNAVIEHASVEGKDEGDKQLDS