Protein Info for PGA1_c02940 in Phaeobacter inhibens DSM 17395

Annotation: 4-hydroxybenzoate octaprenyltransferase UbiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 30 to 312 (283 residues), 317.6 bits, see alignment E=4e-99 PF01040: UbiA" amino acids 47 to 285 (239 residues), 189.6 bits, see alignment E=3.2e-60

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 85% identity to sit:TM1040_3080)

MetaCyc: 64% identical to 4-hydroxybenzoate polyprenyltransferase (Cereibacter sphaeroides)
4-hydroxybenzoate nonaprenyltransferase. [EC: 2.5.1.39]

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETL9 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PGA1_c02940 4-hydroxybenzoate octaprenyltransferase UbiA (Phaeobacter inhibens DSM 17395)
MQGGTPTPDGQVADAVKGNWVDRYAPEWSRPYLRLSRADRPIGTWLLLIPCWWGLMLAIL
WDQSPRWEDLWIFAACAAGAWLMRGAGCTWNDITDRNFDGQVERTRSRPIPSGQVTVTGA
FIWMGLQALISLGILLSFNQAAIAMGILALFPVAIYPFAKRFTWWPQVFLGLAFNWGAML
AWVAHTGTLNWPAVILYLAGIAWTLFYDTIYAHQDTEDDALIGVKSTARLFGTQTPMWLR
RFIVATVSLMAIAIILAVQPQGSVLALMLALAAPWAMGWHMTWQLRVFDAENNDRLLQLF
RLNRDTGLIPLIFFAAALFA